SLC38A2 Antibody Summary
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP |
Specificity | Specificity of human SLC38A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Mouse (96%), Rat (93%). Backed by our Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC38A2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |